PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g082910.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 319aa    MW: 35220.8 Da    PI: 7.4964
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g082910.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-393899263
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                        k++ ++cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrn+PvGgg+rknkksss
  Sopim08g082910.0.1 38 KDQVVNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNIPVGGGSRKNKKSSS 99
                        78999*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-253187IPR003851Zinc finger, Dof-type
PfamPF027017.3E-343996IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9294296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MDTSQWPQEI VMKPMEDIIG NTSKPTNCVE RKLVRPQKDQ VVNCPRCNST NTKFCYYNNY  60
SLSQPRYFCK TCRRYWTEGG SLRNIPVGGG SRKNKKSSSP YNHHVIVNNK KLPDLVVPPP  120
QPDNIEEYPE RHFGNRPHDQ NPSKIILEGS QDLNLGFSSD FKTITDLIQV PNYDGSNKDN  180
NNISTILPPP SSSSSASSPS QLSVMELING ITNNNNNNNN NSFMTMPNSV YNSSGFSLMP  240
SLNFSLDHGI GNDVHHSSSY GNNNNNLQDT NANGRFLFPF VGLKQVSNNT SDGGANEPSL  300
GDQSTNGYWN GMLGGGSW*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245474.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLK4CPT70.0K4CPT7_SOLLC; Uncharacterized protein
STRINGSolyc08g082910.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.16e-47Dof family protein